PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g02740
Common NameGSCOC_T00024781001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 287aa    MW: 31397 Da    PI: 8.4098
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g02740genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.8e-3183137358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  ++rY+eClkNhAas+Gg+++DGCgEfmps geegt +a+kCaAC CHRnFHR+e++
  Cc10_g02740  83 STRYRECLKNHAASIGGNVTDGCGEFMPS-GEEGTLEAFKCAACHCHRNFHRKESS 137
                  689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2183135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.0E-2984136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.1E-2985135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.71586135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.1E-18211281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-30219281IPR009057Homeodomain-like
TIGRFAMsTIGR015658.7E-28220277IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MALTGEDKEM RIPPGSLGYD PLENLDHSTA THHHHHIQHP EDQLIHQEKS SRGPGATAAA  60
LSSGGSKSKT PTPTAGRSHS TSSTRYRECL KNHAASIGGN VTDGCGEFMP SGEEGTLEAF  120
KCAACHCHRN FHRKESSGDG AIVVHQLPLP PPLPSPSMNQ HRGESMNVHA NHWTTMVQPV  180
KMAFGGGSAS AATDSSSEEL NFNAYQSTSV PPPPQFVLAK KRFRTKFSQE QKDKMLAFAE  240
KLGWRIPRED DTEVQRFCTE VGVKRQVFKV WMHNNKNSAK KNPQES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-262212781875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-107PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW71e-62ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A068UH150.0A0A068UH15_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000095812e-89(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-57homeobox protein 31